Lineage for d3azid_ (3azi D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698749Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)
  8. 2698853Domain d3azid_: 3azi D: [239139]
    Other proteins in same PDB: d3azia_, d3azie_
    automated match to d4cayb_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d3azid_

PDB Entry: 3azi (more details), 2.7 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H4K31Q mutation
PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d3azid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azid_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsa

SCOPe Domain Coordinates for d3azid_:

Click to download the PDB-style file with coordinates for d3azid_.
(The format of our PDB-style files is described here.)

Timeline for d3azid_: