| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
| Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
| Protein Xanthine oxidase, domain 5 (?) [54670] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries) Uniprot P80457 |
| Domain d3ax9b6: 3ax9 B:571-694 [239119] Other proteins in same PDB: d3ax9a1, d3ax9a2, d3ax9a3, d3ax9a4, d3ax9a5, d3ax9b1, d3ax9b2, d3ax9b3, d3ax9b4, d3ax9b5 complexed with bct, ca, fad, fes, gol, sal, xax |
PDB Entry: 3ax9 (more details), 2.3 Å
SCOPe Domain Sequences for d3ax9b6:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ax9b6 d.41.1.1 (B:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa
Timeline for d3ax9b6: