Lineage for d3ax9b5 (3ax9 B:224-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987556Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2987594Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 2987595Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 2987609Domain d3ax9b5: 3ax9 B:224-414 [239118]
    Other proteins in same PDB: d3ax9a1, d3ax9a2, d3ax9a3, d3ax9a4, d3ax9a6, d3ax9b1, d3ax9b2, d3ax9b3, d3ax9b4, d3ax9b6
    complexed with bct, ca, fad, fes, gol, sal, xax

Details for d3ax9b5

PDB Entry: 3ax9 (more details), 2.3 Å

PDB Description: Bovine xanthone oxidase, protease cleaved form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ax9b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ax9b5 d.145.1.3 (B:224-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3ax9b5:

Click to download the PDB-style file with coordinates for d3ax9b5.
(The format of our PDB-style files is described here.)

Timeline for d3ax9b5: