Lineage for d3ax7a6 (3ax7 A:571-694)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2551903Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2551904Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2551966Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 2551967Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 2551980Domain d3ax7a6: 3ax7 A:571-694 [239113]
    Other proteins in same PDB: d3ax7a1, d3ax7a2, d3ax7a3, d3ax7a4, d3ax7a5, d3ax7b1, d3ax7b2, d3ax7b3, d3ax7b4, d3ax7b5
    complexed with bct, ca, fad, fes, gol, sal, xax

Details for d3ax7a6

PDB Entry: 3ax7 (more details), 2.34 Å

PDB Description: Bovine Xanthine Oxidase, protease cleaved form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ax7a6:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ax7a6 d.41.1.1 (A:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3ax7a6:

Click to download the PDB-style file with coordinates for d3ax7a6.
(The format of our PDB-style files is described here.)

Timeline for d3ax7a6: