Lineage for d3ax7a5 (3ax7 A:224-414)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223838Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2223878Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 2223879Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 2223892Domain d3ax7a5: 3ax7 A:224-414 [239112]
    Other proteins in same PDB: d3ax7a1, d3ax7a2, d3ax7a3, d3ax7a4, d3ax7a6, d3ax7b1, d3ax7b2, d3ax7b3, d3ax7b4, d3ax7b6
    complexed with bct, ca, fad, fes, gol, sal, xax

Details for d3ax7a5

PDB Entry: 3ax7 (more details), 2.34 Å

PDB Description: Bovine Xanthine Oxidase, protease cleaved form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ax7a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ax7a5 d.145.1.3 (A:224-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3ax7a5:

Click to download the PDB-style file with coordinates for d3ax7a5.
(The format of our PDB-style files is described here.)

Timeline for d3ax7a5: