Lineage for d3al4b_ (3al4 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041291Domain d3al4b_: 3al4 B: [239106]
    Other proteins in same PDB: d3al4a_, d3al4c_, d3al4e_, d3al4g_, d3al4i_, d3al4k_
    automated match to d4n5zb_
    complexed with nag

Details for d3al4b_

PDB Entry: 3al4 (more details), 2.87 Å

PDB Description: crystal structure of the swine-origin a (h1n1)-2009 influenza a virus hemagglutinin (ha) reveals similar antigenicity to that of the 1918 pandemic virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3al4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3al4b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky

SCOPe Domain Coordinates for d3al4b_:

Click to download the PDB-style file with coordinates for d3al4b_.
(The format of our PDB-style files is described here.)

Timeline for d3al4b_: