SCOPe 2.04: Domain d3ae4d_: 3ae4 D:

Lineage for d3ae4d_ (3ae4 D:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Small cytochrome binding protein CybS [254391] (1 species)
   Pfam PF05328; PubMed 15989954

7. Species Pig (Sus scrofa) [TaxId:9823] [254827] (5 PDB entries)

8. Domain d3ae4d_: 3ae4 D: [239099]
   Other proteins in same PDB: d3ae4a1, d3ae4a2, d3ae4a3, d3ae4b1, d3ae4b2, d3ae4c_
   automated match to d1zoyd_
   complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4

Details for d3ae4d_

PDB Entry: 3ae4, 2.91 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide

PDB Compounds: (D:) Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial

SCOPe Domain Sequences for d3ae4d_:

Sequence; same for both SEQRES and ATOM records:

>d3ae4d_ f.21.2.2 (D:) Small cytochrome binding protein CybS {Pig (Sus scrofa) [TaxId: 9823]}
sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
dalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl

Timeline for d3ae4d_:

• d3ae4d_ is new in SCOPe 2.04-stable
  
• d3ae4d_ appears in SCOPe 2.05
  
• d3ae4d_ appears in the current release, SCOPe 2.08