Lineage for d3ae4a3 (3ae4 A:446-622)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985908Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1985909Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1985948Protein Succinate dehydogenase [81708] (2 species)
  7. 1985964Species Pig (Sus scrofa) [TaxId:9823] [254825] (5 PDB entries)
  8. 1985969Domain d3ae4a3: 3ae4 A:446-622 [239097]
    Other proteins in same PDB: d3ae4a1, d3ae4a2, d3ae4b1, d3ae4b2, d3ae4c_, d3ae4d_
    automated match to d1zoya3
    complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4

Details for d3ae4a3

PDB Entry: 3ae4 (more details), 2.91 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3ae4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ae4a3 a.7.3.1 (A:446-622) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
ageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsvlqegcekilrlygdlq
hlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrgaharedfkervdeydys
kpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlneadcatvppairsy

SCOPe Domain Coordinates for d3ae4a3:

Click to download the PDB-style file with coordinates for d3ae4a3.
(The format of our PDB-style files is described here.)

Timeline for d3ae4a3: