Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) |
Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
Protein Succinate dehydogenase [82818] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [254824] (5 PDB entries) |
Domain d3ae4a2: 3ae4 A:274-360 [239096] Other proteins in same PDB: d3ae4a1, d3ae4a3, d3ae4b1, d3ae4b2, d3ae4c_, d3ae4d_ automated match to d1zoya2 complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4 |
PDB Entry: 3ae4 (more details), 2.91 Å
SCOPe Domain Sequences for d3ae4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ae4a2 d.168.1.1 (A:274-360) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]} gilinsqgerfmeryapvakdlasrdvvsrsmtleiregrgcgpekdhvylqlhhlppeq lavrlpgisetamifagvdvtkepipv
Timeline for d3ae4a2:
View in 3D Domains from other chains: (mouse over for more information) d3ae4b1, d3ae4b2, d3ae4c_, d3ae4d_ |