SCOPe 2.05: Domain d3ab3b_: 3ab3 B:

Lineage for d3ab3b_ (3ab3 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d3ab3b_: 3ab3 B: [239094]
   Other proteins in same PDB: d3ab3a1, d3ab3a2, d3ab3c1, d3ab3c2
   automated match to d3cx8b_
   complexed with alf, gdp, mg

Details for d3ab3b_

PDB Entry: 3ab3, 2.4 Å

PDB Description: crystal structure of p115rhogef rgs domain in complex with g alpha 13

PDB Compounds: (B:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3ab3b_:

Sequence, based on SEQRES records:

>d3ab3b_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siigaededfeneletnseeqnsqfqsleqvkrrpahlmallqhvalqfepgpllcclha
dmlgslgpkeakkafldfyhsflektavlrvpvppnvafeldrtradlisedvqrrfvqe
vvqsqqvavgrqledfrskrlmgmtpweqelaqleawvgrdrasyearerhvaerllmhl
eemqhtistdeeksaavvnaiglymrhlgvrt

Sequence, based on observed residues (ATOM records):

>d3ab3b_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siigaededfenefqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgkkafldf
yhsflektavlrvpvppnvafevqrrfvqevvqsqqvavgrqledfrskrlmgmtpweqe
laqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaiglymrhlgv
rt

Timeline for d3ab3b_:

• d3ab3b_ first appeared in SCOPe 2.04
  
• d3ab3b_ appears in SCOPe 2.06
  
• d3ab3b_ appears in the current release, SCOPe 2.08