Lineage for d1dd1b_ (1dd1 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372850Family b.26.1.1: SMAD domain [49880] (5 protein domains)
  6. 2372870Protein Smad4 tumor suppressor C-terminal domain [49881] (1 species)
  7. 2372871Species Human (Homo sapiens) [TaxId:9606] [49882] (6 PDB entries)
    Uniprot Q13485 314-546
  8. 2372874Domain d1dd1b_: 1dd1 B: [23909]
    complexed with so4

Details for d1dd1b_

PDB Entry: 1dd1 (more details), 2.62 Å

PDB Description: crystal structure analysis of the smad4 active fragment
PDB Compounds: (B:) smad4

SCOPe Domain Sequences for d1dd1b_:

Sequence, based on SEQRES records: (download)

>d1dd1b_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdyprqsiketpcw
ieihlhralqlldevlhtmpiadpqpld

Sequence, based on observed residues (ATOM records): (download)

>d1dd1b_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nghlqhhppmppelafqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyv
dpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyl
dreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaavagniapais
lsaaagigvddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtm
piadpqpld

SCOPe Domain Coordinates for d1dd1b_:

Click to download the PDB-style file with coordinates for d1dd1b_.
(The format of our PDB-style files is described here.)

Timeline for d1dd1b_: