SCOPe 2.06: Domain d2zite2: 2zit E:344-481

Lineage for d2zite2 (2zit E:344-481)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (26 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)

8. Domain d2zite2: 2zit E:344-481 [239075]
   Other proteins in same PDB: d2zita1, d2zita3, d2zita4, d2zita5, d2zitb2, d2zitb3, d2zitc1, d2zitc3, d2zitc4, d2zitc5, d2zitd2, d2zitd3, d2zite1, d2zite3, d2zite4, d2zite5, d2zitf2, d2zitf3
   automated match to d1n0ua1
   protein/RNA complex; complexed with nad

Details for d2zite2

PDB Entry: 2zit, 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex

PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d2zite2:

Sequence; same for both SEQRES and ATOM records:

>d2zite2 b.43.3.0 (E:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

Timeline for d2zite2:

• d2zite2 first appeared in SCOPe 2.04
  
• d2zite2 appears in SCOPe 2.05
  
• d2zite2 appears in SCOPe 2.07
  
• d2zite2 appears in the current release, SCOPe 2.08