Lineage for d2zitc3 (2zit C:482-560)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653322Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 1653409Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 1653410Protein automated matches [254469] (2 species)
    not a true protein
  7. 1653411Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries)
  8. 1653414Domain d2zitc3: 2zit C:482-560 [239071]
    Other proteins in same PDB: d2zita1, d2zita2, d2zita4, d2zitb_, d2zitc1, d2zitc2, d2zitc4, d2zitd_, d2zite1, d2zite2, d2zite4, d2zitf_
    automated match to d1n0ua4
    protein/RNA complex; complexed with nad

Details for d2zitc3

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d2zitc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zitc3 d.58.11.0 (C:482-560) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

SCOPe Domain Coordinates for d2zitc3:

Click to download the PDB-style file with coordinates for d2zitc3.
(The format of our PDB-style files is described here.)

Timeline for d2zitc3: