Lineage for d2zhxi_ (2zhx I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855129Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 2855130Protein automated matches [193166] (6 species)
    not a true protein
  7. 2855138Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries)
  8. 2855161Domain d2zhxi_: 2zhx I: [239061]
    Other proteins in same PDB: d2zhxb_, d2zhxd_, d2zhxf_, d2zhxh_, d2zhxj_, d2zhxl_, d2zhxn_
    automated match to d3a7na_
    protein/DNA complex

Details for d2zhxi_

PDB Entry: 2zhx (more details), 3.1 Å

PDB Description: crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor
PDB Compounds: (I:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2zhxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhxi_ c.18.1.0 (I:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
arplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnvrv
livgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaqrg
vlllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmlaag
ncvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp

SCOPe Domain Coordinates for d2zhxi_:

Click to download the PDB-style file with coordinates for d2zhxi_.
(The format of our PDB-style files is described here.)

Timeline for d2zhxi_: