![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.0: automated matches [193165] (1 protein) not a true family |
![]() | Protein automated matches [193166] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries) |
![]() | Domain d2zhxg_: 2zhx G: [239060] Other proteins in same PDB: d2zhxb_, d2zhxd_, d2zhxf_, d2zhxh_, d2zhxj_, d2zhxl_, d2zhxn_ automated match to d3a7na_ protein/DNA complex |
PDB Entry: 2zhx (more details), 3.1 Å
SCOPe Domain Sequences for d2zhxg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhxg_ c.18.1.0 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} arplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnvrv livgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaqrg vlllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmlaag ncvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp
Timeline for d2zhxg_: