Lineage for d1thi__ (1thi -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370997Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 370998Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 370999Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 371007Protein Thaumatin [49876] (1 species)
  7. 371008Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (10 PDB entries)
  8. 371018Domain d1thi__: 1thi - [23906]
    CA-atoms only
    structure in this entry is partly incorrect, correction published

Details for d1thi__

PDB Entry: 1thi (more details), 3.2 Å

PDB Description: crystal structures of two intensely sweet proteins

SCOP Domain Sequences for d1thi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thi__ b.25.1.1 (-) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1thi__:

Click to download the PDB-style file with coordinates for d1thi__.
(The format of our PDB-style files is described here.)

Timeline for d1thi__: