![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries) |
![]() | Domain d2zgsb_: 2zgs B: [239054] automated match to d2zgsa_ mutant |
PDB Entry: 2zgs (more details), 1.9 Å
SCOPe Domain Sequences for d2zgsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zgsb_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]} qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttanlfaengayllhi afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv iqytkqisgltsslsynateetsifstvveavtytgla
Timeline for d2zgsb_: