SCOPe 2.08: Domain d2yvub_: 2yvu B:

Lineage for d2yvub_ (2yvu B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [231666] (4 PDB entries)

8. Domain d2yvub_: 2yvu B: [239052]
   automated match to d2yvua_

Details for d2yvub_

PDB Entry: 2yvu, 2.1 Å

PDB Description: Crystal structure of APE1195

PDB Compounds: (B:) Probable adenylyl-sulfate kinase

SCOPe Domain Sequences for d2yvub_:

Sequence, based on SEQRES records:

>d2yvub_ c.37.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer
lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi
rrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylyslvkavie

Sequence, based on observed residues (ATOM records):

>d2yvub_ c.37.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer
lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi
rrdpkglykkalkgetdpyeppenpqlvldtesntiehnvsylyslvkavie

Timeline for d2yvub_:

• d2yvub_ first appeared in SCOPe 2.04
  
• d2yvub_ appears in SCOPe 2.07