Lineage for d2yood_ (2yoo D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005724Species Mycobacterium smegmatis [TaxId:246196] [231662] (5 PDB entries)
  8. 2005728Domain d2yood_: 2yoo D: [239051]
    automated match to d2yooc_
    complexed with hem, k2b, mg

Details for d2yood_

PDB Entry: 2yoo (more details), 1.69 Å

PDB Description: Cholest-4-en-3-one bound structure of CYP142 from Mycobacterium smegmatis
PDB Compounds: (D:) p450 heme-thiolate protein

SCOPe Domain Sequences for d2yood_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yood_ a.104.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
trpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpelfsst
ggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavcerge
cdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdtfaay
teftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrhtlsgg
teqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelragekim
lmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervlrrlp
dlrladdapvplrpanfvsgpesmpvvftpsapv

SCOPe Domain Coordinates for d2yood_:

Click to download the PDB-style file with coordinates for d2yood_.
(The format of our PDB-style files is described here.)

Timeline for d2yood_: