Lineage for d2ynca1 (2ync A:27-210)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1921929Species Plasmodium vivax [TaxId:5855] [234134] (7 PDB entries)
  8. 1921942Domain d2ynca1: 2ync A:27-210 [239048]
    automated match to d1iica1
    complexed with cl, dms, mg, so4, ync

Details for d2ynca1

PDB Entry: 2ync (more details), 1.75 Å

PDB Description: Plasmodium vivax N-myristoyltransferase in complex with YnC12-CoA thioester.
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d2ynca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynca1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d2ynca1:

Click to download the PDB-style file with coordinates for d2ynca1.
(The format of our PDB-style files is described here.)

Timeline for d2ynca1: