Lineage for d2ymej_ (2yme J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2429246Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2429247Protein automated matches [193506] (5 species)
    not a true protein
  7. 2429248Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2429343Domain d2ymej_: 2yme J: [239047]
    automated match to d2ymef_
    complexed with cwb, na, nag, po4; mutant

Details for d2ymej_

PDB Entry: 2yme (more details), 2.4 Å

PDB Description: crystal structure of a mutant binding protein (5htbp-achbp) in complex with granisetron
PDB Compounds: (J:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2ymej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymej_ b.96.1.0 (J:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2ymej_:

Click to download the PDB-style file with coordinates for d2ymej_.
(The format of our PDB-style files is described here.)

Timeline for d2ymej_: