| Class b: All beta proteins [48724] (176 folds) |
| Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
| Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
| Protein automated matches [193506] (4 species) not a true protein |
| Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (36 PDB entries) |
| Domain d2ymej_: 2yme J: [239047] automated match to d2ymef_ complexed with cwb, na, nag, po4; mutant |
PDB Entry: 2yme (more details), 2.4 Å
SCOPe Domain Sequences for d2ymej_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ymej_ b.96.1.0 (J:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer
Timeline for d2ymej_: