SCOPe 2.07: Domain d1thva_: 1thv A:

Lineage for d1thva_ (1thv A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (113 PDB entries)
   Uniprot P02883

8. Domain d1thva_: 1thv A: [23904]

Details for d1thva_

PDB Entry: 1thv, 1.75 Å

PDB Description: the structures of three crystal forms of the sweet protein thaumatin

PDB Compounds: (A:) thaumatin isoform a

SCOPe Domain Sequences for d1thva_:

Sequence; same for both SEQRES and ATOM records:

>d1thva_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d1thva_:

• d1thva_ first appeared (with stable ids) in SCOP 1.55, called d1thv__
  
• d1thva_ appears in SCOPe 2.06
  
• d1thva_ appears in the current release, SCOPe 2.08