Lineage for d2yc4c_ (2yc4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872010Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255698] (6 PDB entries)
  8. 2872017Domain d2yc4c_: 2yc4 C: [239034]
    Other proteins in same PDB: d2yc4a_, d2yc4b_
    automated match to d3tw8d_
    complexed with ca, cl, mg

Details for d2yc4c_

PDB Entry: 2yc4 (more details), 2.8 Å

PDB Description: intraflagellar transport complex 25-27 from chlamydomonas
PDB Compounds: (C:) small rab-related gtpase

SCOPe Domain Sequences for d2yc4c_:

Sequence, based on SEQRES records: (download)

>d2yc4c_ c.37.1.0 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kpiditatlrckvavvgeatvgksalismftskgskflkdyamtsgvevvvapvtipdtt
vsvelflldtagsdlykeqisqywngvyyailvfdvssmesfesckawfellksarpdre
rplravlvanktdlppqrhqvrldmaqdwattntldffdvsanppgkdadapflsiattf
yrnyedkvaafqdacrny

Sequence, based on observed residues (ATOM records): (download)

>d2yc4c_ c.37.1.0 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kpiditatlrckvavvgeatvgksalismftsvvapvtipdttvsvelflldtagsdlyk
eqisqywngvyyailvfdvssmesfesckawfellksarpdrerplravlvankppqrhq
vrldmaqdwattntldffdvsnppgkdadapflsiattfyrnyedkvaafqdacrny

SCOPe Domain Coordinates for d2yc4c_:

Click to download the PDB-style file with coordinates for d2yc4c_.
(The format of our PDB-style files is described here.)

Timeline for d2yc4c_: