Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
Domain d2xsow1: 2xso W:18-179 [239017] Other proteins in same PDB: d2xsoa2, d2xsob_, d2xsoc2, d2xsod_, d2xsoe2, d2xsof_, d2xsog2, d2xsoh_, d2xsoi2, d2xsoj_, d2xsok2, d2xsol_, d2xsom2, d2xson_, d2xsoo2, d2xsop_, d2xsoq2, d2xsor_, d2xsos2, d2xsot_, d2xsou2, d2xsov_, d2xsow2, d2xsox_ automated match to d2xsha1 complexed with fe2, fes |
PDB Entry: 2xso (more details), 2.2 Å
SCOPe Domain Sequences for d2xsow1:
Sequence, based on SEQRES records: (download)
>d2xsow1 b.33.1.0 (W:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d2xsow1 b.33.1.0 (W:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d2xsow1:
View in 3D Domains from other chains: (mouse over for more information) d2xsoa1, d2xsoa2, d2xsob_, d2xsoc1, d2xsoc2, d2xsod_, d2xsoe1, d2xsoe2, d2xsof_, d2xsog1, d2xsog2, d2xsoh_, d2xsoi1, d2xsoi2, d2xsoj_, d2xsok1, d2xsok2, d2xsol_, d2xsom1, d2xsom2, d2xson_, d2xsoo1, d2xsoo2, d2xsop_, d2xsoq1, d2xsoq2, d2xsor_, d2xsos1, d2xsos2, d2xsot_, d2xsou1, d2xsou2, d2xsov_, d2xsox_ |