SCOPe 2.08: Domain d2xsos2: 2xso S:180-459

Lineage for d2xsos2 (2xso S:180-459)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)

8. Domain d2xsos2: 2xso S:180-459 [239014]
   Other proteins in same PDB: d2xsoa1, d2xsob_, d2xsoc1, d2xsod_, d2xsoe1, d2xsof_, d2xsog1, d2xsoh_, d2xsoi1, d2xsoj_, d2xsok1, d2xsol_, d2xsom1, d2xson_, d2xsoo1, d2xsop_, d2xsoq1, d2xsor_, d2xsos1, d2xsot_, d2xsou1, d2xsov_, d2xsow1, d2xsox_
   automated match to d2xsha2
   complexed with fe2, fes

Details for d2xsos2

PDB Entry: 2xso, 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400

PDB Compounds: (S:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsos2:

Sequence; same for both SEQRES and ATOM records:

>d2xsos2 d.129.3.0 (S:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d2xsos2:

• d2xsos2 first appeared in SCOPe 2.04
  
• d2xsos2 appears in SCOPe 2.07