Lineage for d2xsoq2 (2xso Q:180-459)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192753Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2193064Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2193065Protein automated matches [190218] (22 species)
    not a true protein
  7. 2193068Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2193095Domain d2xsoq2: 2xso Q:180-459 [239012]
    Other proteins in same PDB: d2xsoa1, d2xsob_, d2xsoc1, d2xsod_, d2xsoe1, d2xsof_, d2xsog1, d2xsoh_, d2xsoi1, d2xsoj_, d2xsok1, d2xsol_, d2xsom1, d2xson_, d2xsoo1, d2xsop_, d2xsoq1, d2xsor_, d2xsos1, d2xsot_, d2xsou1, d2xsov_, d2xsow1, d2xsox_
    automated match to d2xsha2
    complexed with fe2, fes

Details for d2xsoq2

PDB Entry: 2xso (more details), 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (Q:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsoq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsoq2 d.129.3.0 (Q:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2xsoq2:

Click to download the PDB-style file with coordinates for d2xsoq2.
(The format of our PDB-style files is described here.)

Timeline for d2xsoq2: