Lineage for d2xsoq1 (2xso Q:18-179)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783175Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1783176Protein automated matches [190701] (10 species)
    not a true protein
  7. 1783182Species Burkholderia xenovorans [TaxId:266265] [226023] (7 PDB entries)
  8. 1783209Domain d2xsoq1: 2xso Q:18-179 [239011]
    Other proteins in same PDB: d2xsoa2, d2xsob_, d2xsoc2, d2xsod_, d2xsoe2, d2xsof_, d2xsog2, d2xsoh_, d2xsoi2, d2xsoj_, d2xsok2, d2xsol_, d2xsom2, d2xson_, d2xsoo2, d2xsop_, d2xsoq2, d2xsor_, d2xsos2, d2xsot_, d2xsou2, d2xsov_, d2xsow2, d2xsox_
    automated match to d2xsha1
    complexed with fe2, fes

Details for d2xsoq1

PDB Entry: 2xso (more details), 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (Q:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsoq1:

Sequence, based on SEQRES records: (download)

>d2xsoq1 b.33.1.0 (Q:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2xsoq1 b.33.1.0 (Q:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2xsoq1:

Click to download the PDB-style file with coordinates for d2xsoq1.
(The format of our PDB-style files is described here.)

Timeline for d2xsoq1: