Lineage for d1du5a_ (1du5 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) 
Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (3 proteins) 
Protein Zeamatin [49874] (1 species) Species Maize (Zea mays) [TaxId:4577] [49875] (1 PDB entry) 
Domain d1du5a_: 1du5 A: [23901]
Details for d1du5a_
PDB Entry: 1du5 (more details), 2.5 Å
PDB Description: the crystal structure of zeamatin.
SCOP Domain Sequences for d1du5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1du5a_ b.25.1.1 (A:) Zeamatin {Maize (Zea mays)}
avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs
crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr
gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda
ysypkddatstftcpagtnykvvfcp
SCOP Domain Coordinates for d1du5a_:
Click to download the PDB-style file with coordinates for d1du5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1du5a_:
- d1du5a_ appears in SCOP 1.57
- d1du5a_ appears in the current release, SCOPe 2.08
View in 3D
