Lineage for d1du5a_ (1du5 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12333Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
  4. 12334Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
  5. 12335Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (3 proteins)
  6. 12345Protein Zeamatin [49874] (1 species)
  7. 12346Species Maize (Zea mays) [TaxId:4577] [49875] (1 PDB entry)
  8. 12347Domain d1du5a_: 1du5 A: [23901]

Details for d1du5a_

PDB Entry: 1du5 (more details), 2.5 Å

PDB Description: the crystal structure of zeamatin.

SCOP Domain Sequences for d1du5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du5a_ b.25.1.1 (A:) Zeamatin {Maize (Zea mays)}
avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs
crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr
gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda
ysypkddatstftcpagtnykvvfcp

SCOP Domain Coordinates for d1du5a_:

Click to download the PDB-style file with coordinates for d1du5a_.
(The format of our PDB-style files is described here.)

Timeline for d1du5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1du5b_