Lineage for d2xsom2 (2xso M:180-459)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582442Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2582467Domain d2xsom2: 2xso M:180-459 [239008]
    Other proteins in same PDB: d2xsoa1, d2xsob_, d2xsoc1, d2xsod_, d2xsoe1, d2xsof_, d2xsog1, d2xsoh_, d2xsoi1, d2xsoj_, d2xsok1, d2xsol_, d2xsom1, d2xson_, d2xsoo1, d2xsop_, d2xsoq1, d2xsor_, d2xsos1, d2xsot_, d2xsou1, d2xsov_, d2xsow1, d2xsox_
    automated match to d2xsha2
    complexed with fe2, fes

Details for d2xsom2

PDB Entry: 2xso (more details), 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (M:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsom2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsom2 d.129.3.0 (M:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2xsom2:

Click to download the PDB-style file with coordinates for d2xsom2.
(The format of our PDB-style files is described here.)

Timeline for d2xsom2: