Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries) |
Domain d2xsog2: 2xso G:180-459 [239002] Other proteins in same PDB: d2xsoa1, d2xsob_, d2xsoc1, d2xsod_, d2xsoe1, d2xsof_, d2xsog1, d2xsoh_, d2xsoi1, d2xsoj_, d2xsok1, d2xsol_, d2xsom1, d2xson_, d2xsoo1, d2xsop_, d2xsoq1, d2xsor_, d2xsos1, d2xsot_, d2xsou1, d2xsov_, d2xsow1, d2xsox_ automated match to d2xsha2 complexed with fe2, fes |
PDB Entry: 2xso (more details), 2.2 Å
SCOPe Domain Sequences for d2xsog2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xsog2 d.129.3.0 (G:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]} apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnniriwhprgpneievwaftlvd adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
Timeline for d2xsog2:
View in 3D Domains from other chains: (mouse over for more information) d2xsoa1, d2xsoa2, d2xsob_, d2xsoc1, d2xsoc2, d2xsod_, d2xsoe1, d2xsoe2, d2xsof_, d2xsoh_, d2xsoi1, d2xsoi2, d2xsoj_, d2xsok1, d2xsok2, d2xsol_, d2xsom1, d2xsom2, d2xson_, d2xsoo1, d2xsoo2, d2xsop_, d2xsoq1, d2xsoq2, d2xsor_, d2xsos1, d2xsos2, d2xsot_, d2xsou1, d2xsou2, d2xsov_, d2xsow1, d2xsow2, d2xsox_ |