SCOPe 2.08: Domain d2xsog1: 2xso G:18-179

Lineage for d2xsog1 (2xso G:18-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)

8. Domain d2xsog1: 2xso G:18-179 [239001]
   Other proteins in same PDB: d2xsoa2, d2xsob_, d2xsoc2, d2xsod_, d2xsoe2, d2xsof_, d2xsog2, d2xsoh_, d2xsoi2, d2xsoj_, d2xsok2, d2xsol_, d2xsom2, d2xson_, d2xsoo2, d2xsop_, d2xsoq2, d2xsor_, d2xsos2, d2xsot_, d2xsou2, d2xsov_, d2xsow2, d2xsox_
   automated match to d2xsha1
   complexed with fe2, fes

Details for d2xsog1

PDB Entry: 2xso, 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400

PDB Compounds: (G:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsog1:

Sequence, based on SEQRES records:

>d2xsog1 b.33.1.0 (G:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2xsog1 b.33.1.0 (G:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d2xsog1:

• d2xsog1 first appeared in SCOPe 2.04
  
• d2xsog1 appears in SCOPe 2.07