Lineage for d1auna_ (1aun A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793908Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 793909Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 793910Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 793915Protein Pathogenesis-related protein 5d [49872] (1 species)
  7. 793916Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [49873] (1 PDB entry)
  8. 793917Domain d1auna_: 1aun A: [23900]

Details for d1auna_

PDB Entry: 1aun (more details), 1.8 Å

PDB Description: pathogenesis-related protein 5d from nicotiana tabacum
PDB Compounds: (A:) pr-5d

SCOP Domain Sequences for d1auna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auna_ b.25.1.1 (A:) Pathogenesis-related protein 5d {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
sypqddptstftctswttdykvmfcpyg

SCOP Domain Coordinates for d1auna_:

Click to download the PDB-style file with coordinates for d1auna_.
(The format of our PDB-style files is described here.)

Timeline for d1auna_: