Lineage for d1aun__ (1aun -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12333Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
  4. 12334Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
  5. 12335Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (3 proteins)
  6. 12336Protein Pathogenesis-related protein 5d [49872] (1 species)
  7. 12337Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [49873] (1 PDB entry)
  8. 12338Domain d1aun__: 1aun - [23900]

Details for d1aun__

PDB Entry: 1aun (more details), 1.8 Å

PDB Description: pathogenesis-related protein 5d from nicotiana tabacum

SCOP Domain Sequences for d1aun__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aun__ b.25.1.1 (-) Pathogenesis-related protein 5d {Common tobacco (Nicotiana tabacum)}
sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
sypqddptstftctswttdykvmfcpyg

SCOP Domain Coordinates for d1aun__:

Click to download the PDB-style file with coordinates for d1aun__.
(The format of our PDB-style files is described here.)

Timeline for d1aun__: