Lineage for d1auna_ (1aun A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. Protein Pathogenesis-related protein 5d [49872] (1 species)
  7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [49873] (1 PDB entry)
  8. Domain d1auna_: 1aun A: [23900]

Details for d1auna_

PDB Entry: 1aun (more details), 1.8 Å

PDB Description: pathogenesis-related protein 5d from nicotiana tabacum
PDB Compounds: (A:) pr-5d

SCOPe Domain Sequences for d1auna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auna_ b.25.1.1 (A:) Pathogenesis-related protein 5d {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
sypqddptstftctswttdykvmfcpyg

SCOPe Domain Coordinates for d1auna_ are not available.

Timeline for d1auna_: