Lineage for d1auna_ (1aun A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2777885Protein Pathogenesis-related protein 5d [49872] (1 species)
  7. 2777886Species Tobacco (Nicotiana tabacum) [TaxId:4097] [49873] (1 PDB entry)
  8. 2777887Domain d1auna_: 1aun A: [23900]

Details for d1auna_

PDB Entry: 1aun (more details), 1.8 Å

PDB Description: pathogenesis-related protein 5d from nicotiana tabacum
PDB Compounds: (A:) pr-5d

SCOPe Domain Sequences for d1auna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auna_ b.25.1.1 (A:) Pathogenesis-related protein 5d {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
sypqddptstftctswttdykvmfcpyg

SCOPe Domain Coordinates for d1auna_:

Click to download the PDB-style file with coordinates for d1auna_.
(The format of our PDB-style files is described here.)

Timeline for d1auna_: