Lineage for d2xb6b1 (2xb6 B:44-598)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (71 PDB entries)
  8. 2136319Domain d2xb6b1: 2xb6 B:44-598 [238994]
    Other proteins in same PDB: d2xb6a2, d2xb6b2, d2xb6c_, d2xb6d_
    automated match to d3b3qa_
    complexed with ca, cl, edo, mes, nag

Details for d2xb6b1

PDB Entry: 2xb6 (more details), 2.6 Å

PDB Description: revisited crystal structure of neurexin1beta-neuroligin4 complex
PDB Compounds: (B:) neuroligin-4, x-linked

SCOPe Domain Sequences for d2xb6b1:

Sequence, based on SEQRES records: (download)

>d2xb6b1 c.69.1.0 (B:44-598) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgirnt
tqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvpteddihdqn
skkpvmvyihggsymegtgnmidgsilasygnvivitinyrlgilgflstgdqaakgnyg
lldqiqalrwieenvgafggdpkrvtifgsgagascvslltlshyseglfqkaiiqsgta
lsswavnyqpakytriladkvgcnmldttdmveclrnknykeliqqtitpatyhiafgpv
idgdvipddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvtpndfdfsvsnfv
dnlygypegkdtlretikfmytdwadkenpetrrktlvalftdhqwvapavatadlhaqy
gsptyfyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvmlsavv
mtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawsrynpkdqlylhiglkprvrdhyr
atkvafwlelvphlh

Sequence, based on observed residues (ATOM records): (download)

>d2xb6b1 c.69.1.0 (B:44-598) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgirnt
tqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvptekkpvmvy
ihggsymegtgnmidgsilasygnvivitinyrlgilgflstgdqaakgnyglldqiqal
rwieenvgafggdpkrvtifgsgagascvslltlshyseglfqkaiiqsgtalsswavny
qpakytriladkvgcnmldttdmveclrnknykeliqqtitpatyhiafgpvidgdvipd
dpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvtpndfdfsvsnfvdnlygype
gkdtlretikfmytdwadkenpetrrktlvalftdhqwvapavatadlhaqygsptyfya
fyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvmlsavvmtywtnfa
ktgdpnqpvvawsrynpkdqlylhiglkprvrdhyratkvafwlelvphlh

SCOPe Domain Coordinates for d2xb6b1:

Click to download the PDB-style file with coordinates for d2xb6b1.
(The format of our PDB-style files is described here.)

Timeline for d2xb6b1: