Lineage for d2x3eb2 (2x3e B:176-327)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918123Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries)
  8. 2918127Domain d2x3eb2: 2x3e B:176-327 [238992]

Details for d2x3eb2

PDB Entry: 2x3e (more details), 1.81 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl carrier protein) synthase iii, fabh from pseudomonas aeruginosa pao1
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2x3eb2:

Sequence, based on SEQRES records: (download)

>d2x3eb2 c.95.1.0 (B:176-327) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
llafdlgsdghqfdllmtpavsraerssgqasnyfrmdgkavfgqavtqmsdsvrrvldr
vgwqasdlhhlvphqantrilaavadqldlpvervvsniaevgntvaasiplalahglrq
gilrdggnmvltgfgagltwgsvalrwpkivp

Sequence, based on observed residues (ATOM records): (download)

>d2x3eb2 c.95.1.0 (B:176-327) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
llafdlgsdghqfdllmtpavsranyfrmdgkavfgqavtqmsdsvrrvldrvgwqasdl
hhlvphqantrilaavadqldlpvervvsniaevgntvaasiplalahglrqgilrdggn
mvltgfgagltwgsvalrwpkivp

SCOPe Domain Coordinates for d2x3eb2:

Click to download the PDB-style file with coordinates for d2x3eb2.
(The format of our PDB-style files is described here.)

Timeline for d2x3eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x3eb1