Lineage for d1egua2 (1egu A:815-893)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532487Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 1532488Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 1532489Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 1532507Protein Hyaluronate lyase [49867] (2 species)
  7. 1532508Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [49868] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 1532515Domain d1egua2: 1egu A:815-893 [23899]
    Other proteins in same PDB: d1egua1, d1egua3
    complexed with so4

Details for d1egua2

PDB Entry: 1egu (more details), 1.56 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase at 1.56 a resolution
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1egua2:

Sequence, based on SEQRES records: (download)

>d1egua2 b.24.1.1 (A:815-893) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkleqh

Sequence, based on observed residues (ATOM records): (download)

>d1egua2 b.24.1.1 (A:815-893) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkqh

SCOPe Domain Coordinates for d1egua2:

Click to download the PDB-style file with coordinates for d1egua2.
(The format of our PDB-style files is described here.)

Timeline for d1egua2: