Lineage for d1egua2 (1egu A:815-893)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108399Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
  4. 108400Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 108401Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins)
  6. 108409Protein Hyaluronate lyase [49867] (2 species)
  7. 108413Species Streptococcus pneumoniae [TaxId:1313] [49868] (3 PDB entries)
  8. 108414Domain d1egua2: 1egu A:815-893 [23899]
    Other proteins in same PDB: d1egua1, d1egua3

Details for d1egua2

PDB Entry: 1egu (more details), 1.56 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase at 1.56 a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1egua2:

Sequence, based on SEQRES records: (download)

>d1egua2 b.24.1.1 (A:815-893) Hyaluronate lyase {Streptococcus pneumoniae}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkleqh

Sequence, based on observed residues (ATOM records): (download)

>d1egua2 b.24.1.1 (A:815-893) Hyaluronate lyase {Streptococcus pneumoniae}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkqh

SCOP Domain Coordinates for d1egua2:

Click to download the PDB-style file with coordinates for d1egua2.
(The format of our PDB-style files is described here.)

Timeline for d1egua2: