![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries) |
![]() | Domain d2x3ea1: 2x3e A:3-175 [238989] |
PDB Entry: 2x3e (more details), 1.81 Å
SCOPe Domain Sequences for d2x3ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x3ea1 c.95.1.0 (A:3-175) automated matches {Pseudomonas aeruginosa [TaxId: 287]} raavvcglgsylpeavlsndmlaaeldtsdawissrtgvrqrhiagdlgsgdlalraasa alasaglervdavvlatstgdfccpataprvaarlglvgalafdlsaaatgfvyglasvg slisagladsallvgvdtfshtldpadrstralfgdgagavvlragdaeeega
Timeline for d2x3ea1: