Lineage for d2wvjh2 (2wvj H:151-191)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262786Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2262787Protein automated matches [190463] (7 species)
    not a true protein
  7. 2262819Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)
  8. 2262836Domain d2wvjh2: 2wvj H:151-191 [238988]
    Other proteins in same PDB: d2wvja1, d2wvjb1, d2wvjc1, d2wvjd1, d2wvje1, d2wvjf1, d2wvjg1, d2wvjh1
    automated match to d2wvjb2
    complexed with mg, ttp, zn; mutant

Details for d2wvjh2

PDB Entry: 2wvj (more details), 2.2 Å

PDB Description: mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine
PDB Compounds: (H:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d2wvjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvjh2 g.39.1.0 (H:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk

SCOPe Domain Coordinates for d2wvjh2:

Click to download the PDB-style file with coordinates for d2wvjh2.
(The format of our PDB-style files is described here.)

Timeline for d2wvjh2: