SCOPe 2.04: Domain d2wvjf2: 2wvj F:151-191

Lineage for d2wvjf2 (2wvj F:151-191)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (9 PDB entries)

8. Domain d2wvjf2: 2wvj F:151-191 [238984]
   Other proteins in same PDB: d2wvja1, d2wvjb1, d2wvjc1, d2wvjd1, d2wvje1, d2wvjf1, d2wvjg1, d2wvjh1
   automated match to d2wvjb2
   complexed with mg, ttp, zn; mutant

Details for d2wvjf2

PDB Entry: 2wvj, 2.2 Å

PDB Description: mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine

PDB Compounds: (F:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d2wvjf2:

Sequence; same for both SEQRES and ATOM records:

>d2wvjf2 g.39.1.0 (F:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk

Timeline for d2wvjf2:

• d2wvjf2 is new in SCOPe 2.04-stable
  
• d2wvjf2 appears in SCOPe 2.05
  
• d2wvjf2 appears in the current release, SCOPe 2.08