![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.0: automated matches [230594] (1 protein) not a true family |
![]() | Protein automated matches [230595] (4 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries) |
![]() | Domain d2wvdd1: 2wvd D:8-60 [238981] Other proteins in same PDB: d2wvda2, d2wvdb2, d2wvdc2, d2wvdd2 automated match to d2wvdb1 complexed with gol, so4 |
PDB Entry: 2wvd (more details), 2.65 Å
SCOPe Domain Sequences for d2wvdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvdd1 a.43.1.0 (D:8-60) automated matches {Helicobacter pylori [TaxId: 85962]} dsiirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn
Timeline for d2wvdd1: