Lineage for d1cb8a2 (1cb8 A:600-700)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793854Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 793855Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 793856Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 793860Protein Chondroitinase AC [49865] (2 species)
  7. 793868Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [49866] (5 PDB entries)
  8. 793869Domain d1cb8a2: 1cb8 A:600-700 [23898]
    Other proteins in same PDB: d1cb8a1, d1cb8a3
    complexed with ca, gcu, gol, man, mfu, ram, xys

Details for d1cb8a2

PDB Entry: 1cb8 (more details), 1.9 Å

PDB Description: chondroitinase ac lyase from flavobacterium heparinum
PDB Compounds: (A:) protein (chondroitinase ac)

SCOP Domain Sequences for d1cb8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb8a2 b.24.1.1 (A:600-700) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
pkvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaa
dplqkektavlsirdlktgktnrvkidfpqqefagatvelk

SCOP Domain Coordinates for d1cb8a2:

Click to download the PDB-style file with coordinates for d1cb8a2.
(The format of our PDB-style files is described here.)

Timeline for d1cb8a2: