SCOPe 2.08: Domain d2wvdc1: 2wvd C:8-60

Lineage for d2wvdc1 (2wvd C:8-60)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.0: automated matches [230594] (1 protein)
   not a true family

6. Protein automated matches [230595] (4 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries)

8. Domain d2wvdc1: 2wvd C:8-60 [238979]
   Other proteins in same PDB: d2wvda2, d2wvdb2, d2wvdc2, d2wvdd2
   automated match to d2wvdb1
   complexed with gol, so4

Details for d2wvdc1

PDB Entry: 2wvd, 2.65 Å

PDB Description: structural and mechanistic insights into helicobacter pylori nikr function

PDB Compounds: (C:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2wvdc1:

Sequence, based on SEQRES records:

>d2wvdc1 a.43.1.0 (C:8-60) automated matches {Helicobacter pylori [TaxId: 85962]}
dsiirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn

Sequence, based on observed residues (ATOM records):

>d2wvdc1 a.43.1.0 (C:8-60) automated matches {Helicobacter pylori [TaxId: 85962]}
dsiirfsvslqqnlldeldnriikngyssrselvrdmireklvednwn

Timeline for d2wvdc1:

• d2wvdc1 first appeared in SCOPe 2.04
  
• d2wvdc1 appears in SCOPe 2.07