SCOPe 2.08: Domain d2wpna_: 2wpn A:

Lineage for d2wpna_ (2wpn A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)

8. Domain d2wpna_: 2wpn A: [238978]
   Other proteins in same PDB: d2wpnb_
   automated match to d3ze9a_
   complexed with cl, fco, fe2, fsx, ni, sby, sf4

Details for d2wpna_

PDB Entry: 2wpn, 2.04 Å

PDB Description: structure of the oxidised, as-isolated nifese hydrogenase from d. vulgaris hildenborough

PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d2wpna_:

Sequence; same for both SEQRES and ATOM records:

>d2wpna_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
rppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaiehmrkvae
kfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgtcaaygg
ipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkngleggl
aevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckgpmtmad
cferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

Timeline for d2wpna_:

• d2wpna_ first appeared in SCOPe 2.04
  
• d2wpna_ appears in SCOPe 2.07