Lineage for d2wp9f2 (2wp9 F:107-238)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689655Protein automated matches [231469] (5 species)
    not a true protein
  7. 2689669Species Escherichia coli [TaxId:562] [231470] (2 PDB entries)
  8. 2689671Domain d2wp9f2: 2wp9 F:107-238 [238975]
    Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9a3, d2wp9b1, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e2, d2wp9e3, d2wp9f1, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i2, d2wp9i3, d2wp9j1, d2wp9k_, d2wp9l_
    automated match to d2wp9b2
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9f2

PDB Entry: 2wp9 (more details), 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
PDB Compounds: (F:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wp9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp9f2 a.1.2.1 (F:107-238) automated matches {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrctsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d2wp9f2:

Click to download the PDB-style file with coordinates for d2wp9f2.
(The format of our PDB-style files is described here.)

Timeline for d2wp9f2: