SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wl4d2 (2wl4 D:269-392)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (57 species)
    not a true protein
  7. 2147757Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries)
  8. 2147769Domain d2wl4d2: 2wl4 D:269-392 [238967]
    Other proteins in same PDB: d2wl4a1, d2wl4b1, d2wl4c1, d2wl4d1
    automated match to d2wl4c2
    complexed with cl, coa, na, so4; mutant

Details for d2wl4d2

PDB Entry: 2wl4 (more details), 1.8 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the h348a mutant with coenzyme a.
PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wl4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wl4d2 c.95.1.0 (D:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaigapigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d2wl4d2:

Click to download the PDB-style file with coordinates for d2wl4d2.
(The format of our PDB-style files is described here.)

Timeline for d2wl4d2: