SCOPe 2.04: Domain d2wl4d1: 2wl4 D:4-268

Lineage for d2wl4d1 (2wl4 D:4-268)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein automated matches [231410] (2 species)
   not a true protein

7. Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries)

8. Domain d2wl4d1: 2wl4 D:4-268 [238966]
   Other proteins in same PDB: d2wl4a2, d2wl4b2, d2wl4c2, d2wl4d2
   automated match to d2wl4c1
   complexed with cl, coa, na, so4; mutant

Details for d2wl4d1

PDB Entry: 2wl4, 1.8 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the h348a mutant with coenzyme a.

PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wl4d1:

Sequence; same for both SEQRES and ATOM records:

>d2wl4d1 c.95.1.1 (D:4-268) automated matches {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

Timeline for d2wl4d1:

• d2wl4d1 is new in SCOPe 2.04-stable
  
• d2wl4d1 appears in SCOPe 2.05
  
• d2wl4d1 appears in the current release, SCOPe 2.08