Lineage for d2wkvd2 (2wkv D:269-392)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525659Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries)
  8. 2525679Domain d2wkvd2: 2wkv D:269-392 [238965]
    Other proteins in same PDB: d2wkva1, d2wkvb1, d2wkvc1, d2wkvd1
    automated match to d2wkva2
    complexed with coa, na, so4; mutant

Details for d2wkvd2

PDB Entry: 2wkv (more details), 2.5 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the n316d mutant with coenzyme a.
PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wkvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkvd2 c.95.1.0 (D:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveadeafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d2wkvd2:

Click to download the PDB-style file with coordinates for d2wkvd2.
(The format of our PDB-style files is described here.)

Timeline for d2wkvd2: